NameTyrosine-protein kinase Fyn
Synonyms
  • 2.7.10.2
  • p59-Fyn
  • Proto-oncogene c-Fyn
  • Proto-oncogene Syn
  • SLK
  • Src-like kinase
Gene NameFYN
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037856|Tyrosine-protein kinase Fyn
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Number of residues537
Molecular Weight60761.49
Theoretical pI6.65
GO Classification
Functions
  • growth factor receptor binding
  • metal ion binding
  • non-membrane spanning protein tyrosine kinase activity
  • protein tyrosine kinase activity
  • ATP binding
  • ephrin receptor binding
  • glycoprotein binding
Processes
  • peptidyl-tyrosine phosphorylation
  • dendrite morphogenesis
  • regulation of cell proliferation
  • activated T cell proliferation
  • regulation of cell shape
  • Fc-epsilon receptor signaling pathway
  • cellular response to peptide hormone stimulus
  • cellular response to transforming growth factor beta stimulus
  • negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
  • platelet activation
  • positive regulation of tyrosine phosphorylation of Stat5 protein
  • leukocyte migration
  • positive regulation of protein localization to nucleus
  • learning
  • ephrin receptor signaling pathway
  • activation of MAPKK activity
  • regulation of defense response to virus by virus
  • regulation of apoptotic process
  • cellular response to platelet-derived growth factor stimulus
  • positive regulation of neuron projection development
  • fibroblast growth factor receptor signaling pathway
  • phosphatidylinositol-mediated signaling
  • negative regulation of protein ubiquitination
  • insulin receptor signaling pathway
  • response to ethanol
  • viral process
  • feeding behavior
  • calcium ion transport
  • MAPK cascade
  • negative regulation of gene expression
  • neuron migration
  • neurotrophin TRK receptor signaling pathway
  • axon guidance
  • T cell activation
  • detection of mechanical stimulus involved in sensory perception of pain
  • transmembrane receptor protein tyrosine kinase signaling pathway
  • protein phosphorylation
  • cell differentiation
  • T cell costimulation
  • T cell receptor signaling pathway
  • adaptive immune response
  • blood coagulation
  • Ras protein signal transduction
  • cell migration
  • negative regulation of neuron apoptotic process
  • negative regulation of protein catabolic process
  • stimulatory C-type lectin receptor signaling pathway
  • epidermal growth factor receptor signaling pathway
  • forebrain development
  • positive regulation of I-kappaB kinase/NF-kappaB signaling
  • response to drug
  • vascular endothelial growth factor receptor signaling pathway
  • Fc-gamma receptor signaling pathway involved in phagocytosis
  • innate immune response
  • positive regulation of phosphatidylinositol 3-kinase signaling
  • peptidyl-tyrosine autophosphorylation
  • small GTPase mediated signal transduction
  • intracellular signal transduction
Components
  • endosome
  • postsynaptic density
  • actin filament
  • cytosol
  • mitochondrion
  • extrinsic component of cytoplasmic side of plasma membrane
  • nucleus
  • plasma membrane
General FunctionProtein tyrosine kinase activity
Specific FunctionNon-receptor tyrosine-protein kinase that plays a role in many biological processes including regulation of cell growth and survival, cell adhesion, integrin-mediated signaling, cytoskeletal remodeling, cell motility, immune response and axon guidance. Inactive FYN is phosphorylated on its C-terminal tail within the catalytic domain. Following activation by PKA, the protein subsequently associates with PTK2/FAK1, allowing PTK2/FAK1 phosphorylation, activation and targeting to focal adhesions. Involved in the regulation of cell adhesion and motility through phosphorylation of CTNNB1 (beta-catenin) and CTNND1 (delta-catenin). Regulates cytoskeletal remodeling by phosphorylating several proteins including the actin regulator WAS and the microtubule-associated proteins MAP2 and MAPT. Promotes cell survival by phosphorylating AGAP2/PIKE-A and preventing its apoptotic cleavage. Participates in signal transduction pathways that regulate the integrity of the glomerular slit diaphragm (an essential part of the glomerular filter of the kidney) by phosphorylating several slit diaphragm components including NPHS1, KIRREL and TRPC6. Plays a role in neural processes by phosphorylating DPYSL2, a multifunctional adapter protein within the central nervous system, ARHGAP32, a regulator for Rho family GTPases implicated in various neural functions, and SNCA, a small pre-synaptic protein. Participates in the downstream signaling pathways that lead to T-cell differentiation and proliferation following T-cell receptor (TCR) stimulation. Also participates in negative feedback regulation of TCR signaling through phosphorylation of PAG1, thereby promoting interaction between PAG1 and CSK and recruitment of CSK to lipid rafts. CSK maintains LCK and FYN in an inactive form. Promotes CD28-induced phosphorylation of VAV1.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID338228
UniProtKB IDP06241
UniProtKB Entry NameFYN_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0010591|Tyrosine-protein kinase Fyn (FYN)
ATGGGCTGTGTGCAATGTAAGGATAAAGAAGCAACAAAACTGACGGAGGAGAGGGACGGC
AGCCTGAACCAGAGCTCTGGGTACCGCTATGGCACAGACCCCACCCCTCAGCACTACCCC
AGCTTCGGTGTGACCTCCATCCCCAACTACAACAACTTCCACGCAGCCGGGGGCCAAGGA
CTCACCGTCTTTGGAGGTGTGAACTCTTCGTCTCATACGGGGACCTTGCGTACGAGAGGA
GGAACAGGAGTGACACTCTTTGTGGCCCTTTATGACTATGAAGCACGGACAGAAGATGAC
CTGAGTTTTCACAAAGGAGAAAAATTTCAAATATTGAACAGCTCGGAAGGAGATTGGTGG
GAAGCCCGCTCCTTGACAACTGGAGAGACAGGTTACATTCCCAGCAATTATGTGGCTCCA
GTTGACTCTATCCAGGCAGAAGAGTGGTACTTTGGAAAACTTGGCCGAAAAGATGCTGAG
CGACAGCTATTGTCCTTTGGAAACCCAAGAGGTACCTTTCTTATCCGCGAGAGTGAAACC
ACCAAAGGTGCCTATTCACTTTCTATCCGTGATTGGGATGATATGAAAGGAGACCATGTC
AAACATTATAAAATTCGCAAACTTGACAATGGTGGATACTACATTACCACCCGGGCCCAG
TTTGAAACACTTCAGCAGCTTGTACAACATTACTCAGAGAGAGCTGCAGGTCTCTGCTGC
CGCCTAGTAGTTCCCTGTCACAAAGGGATGCCAAGGCTTACCGATCTGTCTGTCAAAACC
AAAGATGTCTGGGAAATCCCTCGAGAATCCCTGCAGTTGATCAAGAGACTGGGAAATGGG
CAGTTTGGGGAAGTATGGATGGGTACCTGGAATGGAAACACAAAAGTAGCCATAAAGACT
CTTAAACCAGGCACAATGTCCCCCGAATCATTCCTTGAGGAAGCGCAGATCATGAAGAAG
CTGAAGCACGACAAGCTGGTCCAGCTCTATGCAGTGGTGTCTGAGGAGCCCATCTACATC
GTCACCGAGTATATGAACAAAGGAAGTTTACTGGATTTCTTAAAAGATGGAGAAGGAAGA
GCTCTGAAATTACCAAATCTTGTGGACATGGCAGCACAGGTGGCTGCAGGAATGGCTTAC
ATCGAGCGCATGAATTATATCCATAGAGATCTGCGATCAGCAAACATTCTAGTGGGGAAT
GGACTCATATGCAAGATTGCTGACTTCGGATTGGCCCGATTGATAGAAGACAATGAGTAC
ACAGCAAGACAAGGTGCAAAGTTCCCCATCAAGTGGACGGCCCCCGAGGCAGCCCTGTAC
GGGAGGTTCACAATCAAGTCTGACGTGTGGTCTTTTGGAATCTTACTCACAGAGCTGGTC
ACCAAAGGAAGAGTGCCATACCCAGGCATGAACAACCGGGAGGTGCTGGAGCAGGTGGAG
CGAGGCTACAGGATGCCCTGCCCGCAGGACTGCCCCATCTCTCTGCATGAGCTCATGATC
CACTGCTGGAAAAAGGACCCTGAAGAACGCCCCACTTTTGAGTACTTGCAGAGCTTCCTG
GAAGACTACTTTACCGCGACAGAGCCCCAGTACCAACCTGGTGAAAACCTGTAA
GenBank Gene IDM14333
GeneCard IDNot Available
GenAtlas IDFYN
HGNC IDHGNC:4037
Chromosome Location6
Locus6q21
References
  1. Kawakami T, Pennington CY, Robbins KC: Isolation and oncogenic potential of a novel human src-like gene. Mol Cell Biol. 1986 Dec;6(12):4195-201. 3099169
  2. Semba K, Nishizawa M, Miyajima N, Yoshida MC, Sukegawa J, Yamanashi Y, Sasaki M, Yamamoto T, Toyoshima K: yes-related protooncogene, syn, belongs to the protein-tyrosine kinase family. Proc Natl Acad Sci U S A. 1986 Aug;83(15):5459-63. 3526330
  3. Rigley K, Slocombe P, Proudfoot K, Wahid S, Mandair K, Bebbington C: Human p59fyn(T) regulates OKT3-induced calcium influx by a mechanism distinct from PIP2 hydrolysis in Jurkat T cells. J Immunol. 1995 Feb 1;154(3):1136-45. 7822789
  4. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. 19054851
  5. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. 14574404
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Peters DJ, McGrew BR, Perron DC, Liptak LM, Laudano AP: In vivo phosphorylation and membrane association of the fyn proto-oncogene product in IM-9 human lymphoblasts. Oncogene. 1990 Sep;5(9):1313-9. 1699196
  8. Mustelin T, Pessa-Morikawa T, Autero M, Gassmann M, Andersson LC, Gahmberg CG, Burn P: Regulation of the p59fyn protein tyrosine kinase by the CD45 phosphotyrosine phosphatase. Eur J Immunol. 1992 May;22(5):1173-8. 1533589
  9. Prasad KV, Janssen O, Kapeller R, Raab M, Cantley LC, Rudd CE: Src-homology 3 domain of protein kinase p59fyn mediates binding to phosphatidylinositol 3-kinase in T cells. Proc Natl Acad Sci U S A. 1993 Aug 1;90(15):7366-70. 8394019
  10. Alland L, Peseckis SM, Atherton RE, Berthiaume L, Resh MD: Dual myristylation and palmitylation of Src family member p59fyn affects subcellular localization. J Biol Chem. 1994 Jun 17;269(24):16701-5. 8206991
  11. Raab M, Cai YC, Bunnell SC, Heyeck SD, Berg LJ, Rudd CE: p56Lck and p59Fyn regulate CD28 binding to phosphatidylinositol 3-kinase, growth factor receptor-bound protein GRB-2, and T cell-specific protein-tyrosine kinase ITK: implications for T-cell costimulation. Proc Natl Acad Sci U S A. 1995 Sep 12;92(19):8891-5. 7568038
  12. Price DJ, Rivnay B, Fu Y, Jiang S, Avraham S, Avraham H: Direct association of Csk homologous kinase (CHK) with the diphosphorylated site Tyr568/570 of the activated c-KIT in megakaryocytes. J Biol Chem. 1997 Feb 28;272(9):5915-20. 9038210
  13. da Silva AJ, Li Z, de Vera C, Canto E, Findell P, Rudd CE: Cloning of a novel T-cell protein FYB that binds FYN and SH2-domain-containing leukocyte protein 76 and modulates interleukin 2 production. Proc Natl Acad Sci U S A. 1997 Jul 8;94(14):7493-8. 9207119
  14. Wary KK, Mariotti A, Zurzolo C, Giancotti FG: A requirement for caveolin-1 and associated kinase Fyn in integrin signaling and anchorage-dependent cell growth. Cell. 1998 Sep 4;94(5):625-34. 9741627
  15. Weil R, Levraud JP, Dodon MD, Bessia C, Hazan U, Kourilsky P, Israel A: Altered expression of tyrosine kinases of the Src and Syk families in human T-cell leukemia virus type 1-infected T-cell lines. J Virol. 1999 May;73(5):3709-17. 10196263
  16. Choi S, Park S: Phosphorylation at Tyr-838 in the kinase domain of EphA8 modulates Fyn binding to the Tyr-615 site by enhancing tyrosine kinase activity. Oncogene. 1999 Sep 23;18(39):5413-22. 10498895
  17. Brdicka T, Pavlistova D, Leo A, Bruyns E, Korinek V, Angelisova P, Scherer J, Shevchenko A, Hilgert I, Cerny J, Drbal K, Kuramitsu Y, Kornacker B, Horejsi V, Schraven B: Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation. J Exp Med. 2000 May 1;191(9):1591-604. 10790433
  18. Huang J, Tilly D, Altman A, Sugie K, Grey HM: T-cell receptor antagonists induce Vav phosphorylation by selective activation of Fyn kinase. Proc Natl Acad Sci U S A. 2000 Sep 26;97(20):10923-9. 11005864
  19. Nakamura T, Yamashita H, Takahashi T, Nakamura S: Activated Fyn phosphorylates alpha-synuclein at tyrosine residue 125. Biochem Biophys Res Commun. 2001 Feb 2;280(4):1085-92. 11162638
  20. Korkaya H, Jameel S, Gupta D, Tyagi S, Kumar R, Zafrullah M, Mazumdar M, Lal SK, Xiaofang L, Sehgal D, Das SR, Sahal D: The ORF3 protein of hepatitis E virus binds to Src homology 3 domains and activates MAPK. J Biol Chem. 2001 Nov 9;276(45):42389-400. Epub 2001 Aug 22. 11518702
  21. Wolf RM, Wilkes JJ, Chao MV, Resh MD: Tyrosine phosphorylation of p190 RhoGAP by Fyn regulates oligodendrocyte differentiation. J Neurobiol. 2001 Oct;49(1):62-78. 11536198
  22. Yasuda K, Nagafuku M, Shima T, Okada M, Yagi T, Yamada T, Minaki Y, Kato A, Tani-Ichi S, Hamaoka T, Kosugi A: Cutting edge: Fyn is essential for tyrosine phosphorylation of Csk-binding protein/phosphoprotein associated with glycolipid-enriched microdomains in lipid rafts in resting T cells. J Immunol. 2002 Sep 15;169(6):2813-7. 12218089
  23. Taniguchi S, Liu H, Nakazawa T, Yokoyama K, Tezuka T, Yamamoto T: p250GAP, a neural RhoGAP protein, is associated with and phosphorylated by Fyn. Biochem Biophys Res Commun. 2003 Jun 20;306(1):151-5. 12788081
  24. Hisatsune C, Kuroda Y, Nakamura K, Inoue T, Nakamura T, Michikawa T, Mizutani A, Mikoshiba K: Regulation of TRPC6 channel activity by tyrosine phosphorylation. J Biol Chem. 2004 Apr 30;279(18):18887-94. Epub 2004 Feb 3. 14761972
  25. Meriane M, Tcherkezian J, Webber CA, Danek EI, Triki I, McFarlane S, Bloch-Gallego E, Lamarche-Vane N: Phosphorylation of DCC by Fyn mediates Netrin-1 signaling in growth cone guidance. J Cell Biol. 2004 Nov 22;167(4):687-98. 15557120
  26. Badour K, Zhang J, Shi F, Leng Y, Collins M, Siminovitch KA: Fyn and PTP-PEST-mediated regulation of Wiskott-Aldrich syndrome protein (WASp) tyrosine phosphorylation is required for coupling T cell antigen receptor engagement to WASp effector function and T cell activation. J Exp Med. 2004 Jan 5;199(1):99-112. 14707117
  27. Gorska MM, Stafford SJ, Cen O, Sur S, Alam R: Unc119, a novel activator of Lck/Fyn, is essential for T cell activation. J Exp Med. 2004 Feb 2;199(3):369-79. Epub 2004 Jan 23. 14757743
  28. Palacios EH, Weiss A: Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation. Oncogene. 2004 Oct 18;23(48):7990-8000. 15489916
  29. Zamora-Leon SP, Bresnick A, Backer JM, Shafit-Zagardo B: Fyn phosphorylates human MAP-2c on tyrosine 67. J Biol Chem. 2005 Jan 21;280(3):1962-70. Epub 2004 Nov 9. 15536091
  30. He Z, Cho YY, Ma WY, Choi HS, Bode AM, Dong Z: Regulation of ultraviolet B-induced phosphorylation of histone H3 at serine 10 by Fyn kinase. J Biol Chem. 2005 Jan 28;280(4):2446-54. Epub 2004 Nov 10. 15537652
  31. Yang C, Zhou W, Jeon MS, Demydenko D, Harada Y, Zhou H, Liu YC: Negative regulation of the E3 ubiquitin ligase itch via Fyn-mediated tyrosine phosphorylation. Mol Cell. 2006 Jan 6;21(1):135-41. 16387660
  32. Tang X, Feng Y, Ye K: Src-family tyrosine kinase fyn phosphorylates phosphatidylinositol 3-kinase enhancer-activating Akt, preventing its apoptotic cleavage and promoting cell survival. Cell Death Differ. 2007 Feb;14(2):368-77. Epub 2006 Jul 14. 16841086
  33. Sayegh J, Webb K, Cheng D, Bedford MT, Clarke SG: Regulation of protein arginine methyltransferase 8 (PRMT8) activity by its N-terminal domain. J Biol Chem. 2007 Dec 14;282(50):36444-53. Epub 2007 Oct 9. 17925405
  34. Castano J, Solanas G, Casagolda D, Raurell I, Villagrasa P, Bustelo XR, Garcia de Herreros A, Dunach M: Specific phosphorylation of p120-catenin regulatory domain differently modulates its binding to RhoA. Mol Cell Biol. 2007 Mar;27(5):1745-57. Epub 2006 Dec 28. 17194753
  35. Solheim SA, Torgersen KM, Tasken K, Berge T: Regulation of FynT function by dual domain docking on PAG/Cbp. J Biol Chem. 2008 Feb 1;283(5):2773-83. Epub 2007 Dec 4. 18056706
  36. Harita Y, Kurihara H, Kosako H, Tezuka T, Sekine T, Igarashi T, Hattori S: Neph1, a component of the kidney slit diaphragm, is tyrosine-phosphorylated by the Src family tyrosine kinase and modulates intracellular signaling by binding to Grb2. J Biol Chem. 2008 Apr 4;283(14):9177-86. doi: 10.1074/jbc.M707247200. Epub 2008 Feb 7. 18258597
  37. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. 18088087
  38. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  39. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  40. Voss M, Lettau M, Janssen O: Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening. BMC Immunol. 2009 Oct 6;10:53. doi: 10.1186/1471-2172-10-53. 19807924
  41. Harita Y, Kurihara H, Kosako H, Tezuka T, Sekine T, Igarashi T, Ohsawa I, Ohta S, Hattori S: Phosphorylation of Nephrin Triggers Ca2+ Signaling by Recruitment and Activation of Phospholipase C-{gamma}1. J Biol Chem. 2009 Mar 27;284(13):8951-62. doi: 10.1074/jbc.M806851200. Epub 2009 Jan 29. 19179337
  42. Uchida Y, Ohshima T, Yamashita N, Ogawara M, Sasaki Y, Nakamura F, Goshima Y: Semaphorin3A signaling mediated by Fyn-dependent tyrosine phosphorylation of collapsin response mediator protein 2 at tyrosine 32. J Biol Chem. 2009 Oct 2;284(40):27393-401. doi: 10.1074/jbc.M109.000240. Epub 2009 Aug 3. 19652227
  43. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195
  44. Goh YM, Cinghu S, Hong ET, Lee YS, Kim JH, Jang JW, Li YH, Chi XZ, Lee KS, Wee H, Ito Y, Oh BC, Bae SC: Src kinase phosphorylates RUNX3 at tyrosine residues and localizes the protein in the cytoplasm. J Biol Chem. 2010 Mar 26;285(13):10122-9. doi: 10.1074/jbc.M109.071381. Epub 2010 Jan 25. 20100835
  45. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  46. Wiede F, Shields BJ, Chew SH, Kyparissoudis K, van Vliet C, Galic S, Tremblay ML, Russell SM, Godfrey DI, Tiganis T: T cell protein tyrosine phosphatase attenuates T cell signaling to maintain tolerance in mice. J Clin Invest. 2011 Dec;121(12):4758-74. doi: 10.1172/JCI59492. Epub 2011 Nov 14. 22080863
  47. Noble ME, Musacchio A, Saraste M, Courtneidge SA, Wierenga RK: Crystal structure of the SH3 domain in human Fyn; comparison of the three-dimensional structures of SH3 domains in tyrosine kinases and spectrin. EMBO J. 1993 Jul;12(7):2617-24. 7687536
  48. Musacchio A, Saraste M, Wilmanns M: High-resolution crystal structures of tyrosine kinase SH3 domains complexed with proline-rich peptides. Nat Struct Biol. 1994 Aug;1(8):546-51. 7664083
  49. Renzoni DA, Pugh DJ, Siligardi G, Das P, Morton CJ, Rossi C, Waterfield MD, Campbell ID, Ladbury JE: Structural and thermodynamic characterization of the interaction of the SH3 domain from Fyn with the proline-rich binding site on the p85 subunit of PI3-kinase. Biochemistry. 1996 Dec 10;35(49):15646-53. 8961927
  50. Lee CH, Saksela K, Mirza UA, Chait BT, Kuriyan J: Crystal structure of the conserved core of HIV-1 Nef complexed with a Src family SH3 domain. Cell. 1996 Jun 14;85(6):931-42. 8681387
  51. Morton CJ, Pugh DJ, Brown EL, Kahmann JD, Renzoni DA, Campbell ID: Solution structure and peptide binding of the SH3 domain from human Fyn. Structure. 1996 Jun 15;4(6):705-14. 8805554
  52. Mulhern TD, Shaw GL, Morton CJ, Day AJ, Campbell ID: The SH2 domain from the tyrosine kinase Fyn in complex with a phosphotyrosyl peptide reveals insights into domain stability and binding specificity. Structure. 1997 Oct 15;5(10):1313-23. 9351806
  53. Chan B, Lanyi A, Song HK, Griesbach J, Simarro-Grande M, Poy F, Howie D, Sumegi J, Terhorst C, Eck MJ: SAP couples Fyn to SLAM immune receptors. Nat Cell Biol. 2003 Feb;5(2):155-60. 12545174
  54. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. 17344846