NameUbiquitin-conjugating enzyme E2 N
Synonyms
  • 2.3.2.23
  • Bendless-like ubiquitin-conjugating enzyme
  • BLU
  • E2 ubiquitin-conjugating enzyme N
  • Ubc13
  • UbcH13
  • Ubiquitin carrier protein N
  • Ubiquitin-protein ligase N
Gene NameUBE2N
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013924|Ubiquitin-conjugating enzyme E2 N
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
Number of residues152
Molecular Weight17137.625
Theoretical pINot Available
GO Classification
Functions
  • ATP binding
  • ubiquitin protein ligase binding
  • ubiquitin protein ligase activity
  • ubiquitin-protein transferase activity
  • poly(A) RNA binding
  • ubiquitin conjugating enzyme activity
  • ubiquitin binding
Processes
  • positive regulation of histone modification
  • toll-like receptor 5 signaling pathway
  • innate immune response
  • positive regulation of ubiquitin-protein transferase activity
  • toll-like receptor 9 signaling pathway
  • Fc-epsilon receptor signaling pathway
  • stimulatory C-type lectin receptor signaling pathway
  • postreplication repair
  • toll-like receptor signaling pathway
  • cytokine-mediated signaling pathway
  • protein K63-linked ubiquitination
  • proteolysis
  • toll-like receptor TLR1
  • regulation of DNA repair
  • toll-like receptor TLR6
  • double-strand break repair via nonhomologous end joining
  • regulation of histone ubiquitination
  • DNA repair
  • global genome nucleotide-excision repair
  • protein ubiquitination
  • T cell receptor signaling pathway
  • positive regulation of DNA repair
  • nucleotide-excision repair
  • nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway
  • positive regulation of I-kappaB kinase/NF-kappaB signaling
  • nucleotide-binding oligomerization domain containing signaling pathway
  • positive regulation of NF-kappaB transcription factor activity
  • ubiquitin-dependent protein catabolic process
  • MyD88-dependent toll-like receptor signaling pathway
  • toll-like receptor 10 signaling pathway
  • cellular protein modification process
  • toll-like receptor 2 signaling pathway
  • double-strand break repair
  • DNA double-strand break processing
  • histone ubiquitination
  • toll-like receptor 4 signaling pathway
  • double-strand break repair via homologous recombination
Components
  • cytoplasm
  • protein complex
  • nucleus
  • ubiquitin ligase complex
  • cytosol
  • extracellular exosome
  • nucleolus
  • nucleoplasm
  • UBC13-MMS2 complex
  • UBC13-UEV1A complex
General FunctionUbiquitin-protein transferase activity
Specific FunctionThe UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP61088
UniProtKB Entry NameUBE2N_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013925|Ubiquitin-conjugating enzyme E2 N (UBE2N)
ATGGCCGGGCTGCCCCGCAGGATCATCAAGGAAACCCAGCGTTTGCTGGCAGAACCAGTT
CCTGGCATCAAAGCCGAACCAGATGAGAGCAACGCCCGTTATTTTCATGTGGTCATTGCT
GGCCCTCAGGATTCCCCCTTTGAGGGAGGGACTTTTAAACTTGAACTATTCCTTCCAGAA
GAATACCCAATGGCAGCCCCTAAAGTACGTTTCATGACCAAAATTTATCATCCTAATGTA
GACAAGTTGGGAAGAATATGTTTAGATATTTTGAAAGATAAGTGGTCCCCAGCACTGCAG
ATCCGCACAGTTCTGCTATCGATCCAGGCCTTGTTAAGTGCTCCCAATCCAGATGATCCA
TTAGCAAATGATGTAGCGGAGCAGTGGAAGACCAACGAAGCCCAAGCCATAGAAACAGCT
AGAGCATGGACTAGGCTATATGCCATGAATAATATTTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:12492
Chromosome Location12
LocusNot Available
References
  1. Yamaguchi T, Kim NS, Sekine S, Seino H, Osaka F, Yamao F, Kato S: Cloning and expression of cDNA encoding a human ubiquitin-conjugating enzyme similar to the Drosophila bendless gene product. J Biochem. 1996 Sep;120(3):494-97. 8902611
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Zou W, Papov V, Malakhova O, Kim KI, Dao C, Li J, Zhang DE: ISG15 modification of ubiquitin E2 Ubc13 disrupts its ability to form thioester bond with ubiquitin. Biochem Biophys Res Commun. 2005 Oct 14;336(1):61-8. 16122702
  4. Hofmann RM, Pickart CM: Noncanonical MMS2-encoded ubiquitin-conjugating enzyme functions in assembly of novel polyubiquitin chains for DNA repair. Cell. 1999 Mar 5;96(5):645-53. 10089880
  5. Bothos J, Summers MK, Venere M, Scolnick DM, Halazonetis TD: The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains. Oncogene. 2003 Oct 16;22(46):7101-7. 14562038
  6. Takeuchi T, Yokosawa H: ISG15 modification of Ubc13 suppresses its ubiquitin-conjugating activity. Biochem Biophys Res Commun. 2005 Oct 14;336(1):9-13. 16112642
  7. Motegi A, Sood R, Moinova H, Markowitz SD, Liu PP, Myung K: Human SHPRH suppresses genomic instability through proliferating cell nuclear antigen polyubiquitination. J Cell Biol. 2006 Dec 4;175(5):703-8. Epub 2006 Nov 27. 17130289
  8. Plans V, Scheper J, Soler M, Loukili N, Okano Y, Thomson TM: The RING finger protein RNF8 recruits UBC13 for lysine 63-based self polyubiquitylation. J Cell Biochem. 2006 Feb 15;97(3):572-82. 16215985
  9. Unk I, Hajdu I, Fatyol K, Szakal B, Blastyak A, Bermudez V, Hurwitz J, Prakash L, Prakash S, Haracska L: Human SHPRH is a ubiquitin ligase for Mms2-Ubc13-dependent polyubiquitylation of proliferating cell nuclear antigen. Proc Natl Acad Sci U S A. 2006 Nov 28;103(48):18107-12. Epub 2006 Nov 15. 17108083
  10. Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG: Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation. J Biol Chem. 2007 Feb 9;282(6):4102-12. Epub 2006 Nov 29. 17135271
  11. Unk I, Hajdu I, Fatyol K, Hurwitz J, Yoon JH, Prakash L, Prakash S, Haracska L: Human HLTF functions as a ubiquitin ligase for proliferating cell nuclear antigen polyubiquitination. Proc Natl Acad Sci U S A. 2008 Mar 11;105(10):3768-73. doi: 10.1073/pnas.0800563105. Epub 2008 Mar 3. 18316726
  12. Motegi A, Liaw HJ, Lee KY, Roest HP, Maas A, Wu X, Moinova H, Markowitz SD, Ding H, Hoeijmakers JH, Myung K: Polyubiquitination of proliferating cell nuclear antigen by HLTF and SHPRH prevents genomic instability from stalled replication forks. Proc Natl Acad Sci U S A. 2008 Aug 26;105(34):12411-6. doi: 10.1073/pnas.0805685105. Epub 2008 Aug 21. 18719106
  13. Stewart GS, Panier S, Townsend K, Al-Hakim AK, Kolas NK, Miller ES, Nakada S, Ylanko J, Olivarius S, Mendez M, Oldreive C, Wildenhain J, Tagliaferro A, Pelletier L, Taubenheim N, Durandy A, Byrd PJ, Stankovic T, Taylor AM, Durocher D: The RIDDLE syndrome protein mediates a ubiquitin-dependent signaling cascade at sites of DNA damage. Cell. 2009 Feb 6;136(3):420-34. doi: 10.1016/j.cell.2008.12.042. 19203578
  14. Tcherpakov M, Delaunay A, Toth J, Kadoya T, Petroski MD, Ronai ZA: Regulation of endoplasmic reticulum-associated degradation by RNF5-dependent ubiquitination of JNK-associated membrane protein (JAMP). J Biol Chem. 2009 May 1;284(18):12099-109. doi: 10.1074/jbc.M808222200. Epub 2009 Mar 6. 19269966
  15. Marteijn JA, van der Meer LT, Smit JJ, Noordermeer SM, Wissink W, Jansen P, Swarts HG, Hibbert RG, de Witte T, Sixma TK, Jansen JH, van der Reijden BA: The ubiquitin ligase Triad1 inhibits myelopoiesis through UbcH7 and Ubc13 interacting domains. Leukemia. 2009 Aug;23(8):1480-9. doi: 10.1038/leu.2009.57. Epub 2009 Apr 2. 19340006
  16. Scheper J, Oliva B, Villa-Freixa J, Thomson TM: Analysis of electrostatic contributions to the selectivity of interactions between RING-finger domains and ubiquitin-conjugating enzymes. Proteins. 2009 Jan;74(1):92-103. doi: 10.1002/prot.22120. 18615712
  17. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  18. David Y, Ziv T, Admon A, Navon A: The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines. J Biol Chem. 2010 Mar 19;285(12):8595-604. doi: 10.1074/jbc.M109.089003. Epub 2010 Jan 8. 20061386
  19. Nakada S, Tai I, Panier S, Al-Hakim A, Iemura S, Juang YC, O'Donnell L, Kumakubo A, Munro M, Sicheri F, Gingras AC, Natsume T, Suda T, Durocher D: Non-canonical inhibition of DNA damage-dependent ubiquitination by OTUB1. Nature. 2010 Aug 19;466(7309):941-6. doi: 10.1038/nature09297. 20725033
  20. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  21. Pertel T, Hausmann S, Morger D, Zuger S, Guerra J, Lascano J, Reinhard C, Santoni FA, Uchil PD, Chatel L, Bisiaux A, Albert ML, Strambio-De-Castillia C, Mothes W, Pizzato M, Grutter MG, Luban J: TRIM5 is an innate immune sensor for the retrovirus capsid lattice. Nature. 2011 Apr 21;472(7343):361-5. doi: 10.1038/nature09976. 21512573
  22. Cotta-Ramusino C, McDonald ER 3rd, Hurov K, Sowa ME, Harper JW, Elledge SJ: A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling. Science. 2011 Jun 10;332(6035):1313-7. doi: 10.1126/science.1203430. 21659603
  23. Bade VN, Nickels J, Keusekotten K, Praefcke GJ: Covalent protein modification with ISG15 via a conserved cysteine in the hinge region. PLoS One. 2012;7(6):e38294. doi: 10.1371/journal.pone.0038294. Epub 2012 Jun 5. 22693631
  24. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  25. Moraes TF, Edwards RA, McKenna S, Pastushok L, Xiao W, Glover JN, Ellison MJ: Crystal structure of the human ubiquitin conjugating enzyme complex, hMms2-hUbc13. Nat Struct Biol. 2001 Aug;8(8):669-73. 11473255
  26. Zhang M, Windheim M, Roe SM, Peggie M, Cohen P, Prodromou C, Pearl LH: Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex. Mol Cell. 2005 Nov 23;20(4):525-38. 16307917
  27. Campbell SJ, Edwards RA, Leung CC, Neculai D, Hodge CD, Dhe-Paganon S, Glover JN: Molecular insights into the function of RING finger (RNF)-containing proteins hRNF8 and hRNF168 in Ubc13/Mms2-dependent ubiquitylation. J Biol Chem. 2012 Jul 6;287(28):23900-10. doi: 10.1074/jbc.M112.359653. Epub 2012 May 15. 22589545
  28. Juang YC, Landry MC, Sanches M, Vittal V, Leung CC, Ceccarelli DF, Mateo AR, Pruneda JN, Mao DY, Szilard RK, Orlicky S, Munro M, Brzovic PS, Klevit RE, Sicheri F, Durocher D: OTUB1 co-opts Lys48-linked ubiquitin recognition to suppress E2 enzyme function. Mol Cell. 2012 Feb 10;45(3):384-97. doi: 10.1016/j.molcel.2012.01.011. 22325355
  29. Wiener R, Zhang X, Wang T, Wolberger C: The mechanism of OTUB1-mediated inhibition of ubiquitination. Nature. 2012 Feb 22;483(7391):618-22. doi: 10.1038/nature10911. 22367539