NameG-protein coupled estrogen receptor 1
Synonyms
  • CEPR
  • Chemoattractant receptor-like 2
  • CMKRL2
  • DRY12
  • FEG-1
  • Flow-induced endothelial G-protein coupled receptor 1
  • G protein-coupled estrogen receptor 1
  • G-protein coupled receptor 30
  • GPCR-Br
  • GPER
  • GPR30
  • IL8-related receptor DRY12
  • LYGPR
  • Lymphocyte-derived G-protein coupled receptor
  • Membrane estrogen receptor
  • mER
Gene NameGPER1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0020690|G-protein coupled estrogen receptor 1
MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLF
LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLH
ERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGL
IWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRV
LVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH
AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVI
PDSTEQSDVRFSSAV
Number of residues375
Molecular Weight42247.12
Theoretical pI8.36
GO Classification
Functions
  • chromatin binding
  • estrogen receptor activity
  • mineralocorticoid receptor activity
  • drug binding
  • G-protein coupled receptor activity
  • steroid binding
  • steroid hormone binding
Processes
  • positive regulation of cell migration
  • negative regulation of fat cell differentiation
  • cellular response to glucose stimulus
  • negative regulation of cell proliferation
  • positive regulation of endothelial cell apoptotic process
  • positive regulation of uterine smooth muscle contraction
  • positive regulation of transcription from RNA polymerase II promoter
  • steroid hormone mediated signaling pathway
  • neuronal action potential
  • negative regulation of ERK1 and ERK2 cascade
  • apoptotic chromosome condensation
  • inflammatory response
  • positive regulation of ERK1 and ERK2 cascade
  • cellular response to peptide hormone stimulus
  • cell cycle
  • positive regulation of gene expression
  • negative regulation of cell cycle arrest
  • negative regulation of gene expression
  • G-protein coupled receptor signaling pathway
  • negative regulation of protein kinase B signaling
  • cytosolic calcium ion homeostasis
  • mineralocorticoid receptor signaling pathway
  • positive regulation of MAPK cascade
  • positive regulation of cell proliferation
  • negative regulation of cell cycle process
  • positive regulation of establishment of protein localization to plasma membrane
  • positive regulation of phosphatidylinositol 3-kinase signaling
  • negative regulation of DNA metabolic process
  • innate immune response
  • positive regulation of epidermal growth factor receptor signaling pathway
  • positive regulation of extrinsic apoptotic signaling pathway
  • positive regulation of release of sequestered calcium ion into cytosol
  • negative regulation of leukocyte activation
  • positive regulation of apoptotic process
  • positive regulation of release of cytochrome c from mitochondria
  • positive regulation of neurogenesis
  • positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway
  • negative regulation of lipid biosynthetic process
  • negative regulation of vascular smooth muscle cell proliferation
  • positive regulation of cytosolic calcium ion concentration
  • positive regulation of G-protein coupled receptor protein signaling pathway
  • positive regulation of vasodilation
  • nuclear fragmentation involved in apoptotic nuclear change
  • positive regulation of protein phosphorylation
  • positive regulation of inositol trisphosphate biosynthetic process
  • intracellular steroid hormone receptor signaling pathway
  • negative regulation of inflammatory response
  • cellular response to estradiol stimulus
  • positive regulation of cardiac vascular smooth muscle cell differentiation
  • cellular response to mineralocorticoid stimulus
  • positive regulation of cAMP biosynthetic process
  • positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
  • positive regulation of neurotransmitter secretion
  • cellular response to tumor necrosis factor
  • positive regulation of insulin secretion
Components
  • dendritic spine membrane
  • plasma membrane
  • neuronal postsynaptic density
  • nuclear envelope
  • endoplasmic reticulum membrane
  • Golgi membrane
  • presynaptic membrane
  • axon terminus
  • dendrite
  • dendritic spine head
  • mitochondrial membrane
  • dendritic shaft
  • cell junction
  • presynaptic active zone
  • Golgi apparatus
  • cytosol
  • keratin filament
  • perinuclear region of cytoplasm
  • cytoplasmic vesicle membrane
  • intracellular
  • cytoplasm
  • axon
  • postsynaptic density
  • nucleus
  • integral component of plasma membrane
  • early endosome
  • trans-Golgi network
  • endoplasmic reticulum
  • recycling endosome
General FunctionSteroid hormone binding
Specific FunctionG-protein coupled estrogen receptor that binds to 17-beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Stimulates cAMP production, calcium mobilization and tyrosine kinase Src inducing the release of heparin-bound epidermal growth factor (HB-EGF) and subsequent transactivation of the epidermal growth factor receptor (EGFR), activating downstream signaling pathways such as PI3K/Akt and ERK/MAPK. Mediates pleiotropic functions among others in the cardiovascular, endocrine, reproductive, immune and central nervous systems. Has a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a RAMP3-dependent manner. Regulates arterial blood pressure by stimulating vasodilation and reducing vascular smooth muscle and microvascular endothelial cell proliferation. Plays a role in blood glucose homeostasis contributing to the insulin secretion response by pancreatic beta cells. Triggers mitochondrial apoptosis during pachytene spermatocyte differentiation. Stimulates uterine epithelial cell proliferation. Enhances uterine contractility in response to oxytocin. Contributes to thymic atrophy by inducing apoptosis. Attenuates TNF-mediated endothelial expression of leukocyte adhesion molecules. Promotes neuritogenesis in developing hippocampal neurons. Plays a role in acute neuroprotection against NMDA-induced excitotoxic neuronal death. Increases firing activity and intracellular calcium oscillations in luteinizing hormone-releasing hormone (LHRH) neurons. Inhibits early osteoblast proliferation at growth plate during skeletal development. Inhibits mature adipocyte differentiation and lipid accumulation. Involved in the recruitment of beta-arrestin 2 ARRB2 at the plasma membrane in epithelial cells. Functions also as a receptor for aldosterone mediating rapid regulation of vascular contractibility through the PI3K/ERK signaling pathway. Involved in cancer progression regulation. Stimulates cancer-associated fibroblast (CAF) proliferation by a rapid genomic response through the EGFR/ERK transduction pathway. Associated with EGFR, may act as a transcription factor activating growth regulatory genes (c-fos, cyclin D1). Promotes integrin alpha-5/beta-1 and fibronectin (FN) matrix assembly in breast cancer cells.
Pfam Domain Function
Transmembrane Regions63-84 97-120 133-153 176-194 221-236 260-280 307-327
GenBank Protein IDNot Available
UniProtKB IDQ99527
UniProtKB Entry NameGPER1_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0020691|G-protein coupled estrogen receptor 1 (GPER1)
ATGGATGTGACTTCCCAAGCCCGGGGCGTGGGCCTGGAGATGTACCCAGGCACCGCGCAG
CCTGCGGCCCCCAACACCACCTCCCCCGAGCTCAACCTGTCCCACCCGCTCCTGGGCACC
GCCCTGGCCAATGGGACAGGTGAGCTCTCGGAGCACCAGCAGTACGTGATCGGCCTGTTC
CTCTCGTGCCTCTACACCATCTTCCTCTTCCCCATCGGCTTTGTGGGCAACATCCTGATC
CTGGTGGTGAACATCAGCTTCCGCGAGAAGATGACCATCCCCGACCTGTACTTCATCAAC
CTGGCGGTGGCGGACCTCATCCTGGTGGCCGACTCCCTCATTGAGGTGTTCAACCTGCAC
GAGCGGTACTACGACATCGCCGTCCTGTGCACCTTCATGTCGCTCTTCCTGCAGGTCAAC
ATGTACAGCAGCGTCTTCTTCCTCACCTGGATGAGCTTCGACCGCTACATCGCCCTGGCC
AGGGCCATGCGCTGCAGCCTGTTCCGCACCAAGCACCACGCCCGGCTGAGCTGTGGCCTC
ATCTGGATGGCATCCGTGTCAGCCACGCTGGTGCCCTTCACCGCCGTGCACCTGCAGCAC
ACCGACGAGGCCTGCTTCTGTTTCGCGGATGTCCGGGAGGTGCAGTGGCTCGAGGTCACG
CTGGGCTTCATCGTGCCCTTCGCCATCATCGGCCTGTGCTACTCCCTCATTGTCCGGGTG
CTGGTCAGGGCGCACCGGCACCGTGGGCTGCGGCCCCGGCGGCAGAAGGCGCTCCGCATG
ATCCTCGCGGTGGTGCTGGTCTTCTTCGTCTGCTGGCTGCCGGAGAACGTCTTCATCAGC
GTGCACCTCCTGCAGCGGACGCAGCCTGGGGCCGCTCCCTGCAAGCAGTCTTTCCGCCAT
GCCCACCCCCTCACGGGCCACATTGTCAACCTCGCCGCCTTCTCCAACAGCTGCCTAAAC
CCCCTCATCTACAGCTTTCTCGGGGAGACCTTCAGGGACAAGCTGAGGCTGTACATTGAG
CAGAAAACAAATTTGCCGGCCCTGAACCGCTTCTGTCACGCTGCCCTGAAGGCCGTCATT
CCAGACAGCACCGAGCAGTCGGATGTGAGGTTCAGCAGTGCCGTGTAG
GenBank Gene IDBC011634
GeneCard IDNot Available
GenAtlas IDGPER
HGNC IDHGNC:4485
Chromosome Location7
LocusNot Available
References
  1. Owman C, Blay P, Nilsson C, Lolait SJ: Cloning of human cDNA encoding a novel heptahelix receptor expressed in Burkitt's lymphoma and widely distributed in brain and peripheral tissues. Biochem Biophys Res Commun. 1996 Nov 12;228(2):285-92. 8920907
  2. Feng Y, Gregor P: Cloning of a novel member of the G protein-coupled receptor family related to peptide receptors. Biochem Biophys Res Commun. 1997 Feb 24;231(3):651-4. 9070864
  3. Takada Y, Kato C, Kondo S, Korenaga R, Ando J: Cloning of cDNAs encoding G protein-coupled receptor expressed in human endothelial cells exposed to fluid shear stress. Biochem Biophys Res Commun. 1997 Nov 26;240(3):737-41. 9398636
  4. Kvingedal AM, Smeland EB: A novel putative G-protein-coupled receptor expressed in lung, heart and lymphoid tissue. FEBS Lett. 1997 Apr 21;407(1):59-62. 9141481
  5. Carmeci C, Thompson DA, Ring HZ, Francke U, Weigel RJ: Identification of a gene (GPR30) with homology to the G-protein-coupled receptor superfamily associated with estrogen receptor expression in breast cancer. Genomics. 1997 Nov 1;45(3):607-17. 9367686
  6. O'Dowd BF, Nguyen T, Marchese A, Cheng R, Lynch KR, Heng HH, Kolakowski LF Jr, George SR: Discovery of three novel G-protein-coupled receptor genes. Genomics. 1998 Jan 15;47(2):310-3. 9479505
  7. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  8. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. 19054851
  9. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. 12690205
  10. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  11. Filardo EJ, Quinn JA, Bland KI, Frackelton AR Jr: Estrogen-induced activation of Erk-1 and Erk-2 requires the G protein-coupled receptor homolog, GPR30, and occurs via trans-activation of the epidermal growth factor receptor through release of HB-EGF. Mol Endocrinol. 2000 Oct;14(10):1649-60. 11043579
  12. Ahola TM, Purmonen S, Pennanen P, Zhuang YH, Tuohimaa P, Ylikomi T: Progestin upregulates G-protein-coupled receptor 30 in breast cancer cells. Eur J Biochem. 2002 May;269(10):2485-90. 12027886
  13. Thomas P, Pang Y, Filardo EJ, Dong J: Identity of an estrogen membrane receptor coupled to a G protein in human breast cancer cells. Endocrinology. 2005 Feb;146(2):624-32. Epub 2004 Nov 11. 15539556
  14. Revankar CM, Cimino DF, Sklar LA, Arterburn JB, Prossnitz ER: A transmembrane intracellular estrogen receptor mediates rapid cell signaling. Science. 2005 Mar 11;307(5715):1625-30. Epub 2005 Feb 10. 15705806
  15. Pedram A, Razandi M, Levin ER: Nature of functional estrogen receptors at the plasma membrane. Mol Endocrinol. 2006 Sep;20(9):1996-2009. Epub 2006 Apr 27. 16645038
  16. Filardo E, Quinn J, Pang Y, Graeber C, Shaw S, Dong J, Thomas P: Activation of the novel estrogen receptor G protein-coupled receptor 30 (GPR30) at the plasma membrane. Endocrinology. 2007 Jul;148(7):3236-45. Epub 2007 Mar 22. 17379646
  17. Otto C, Rohde-Schulz B, Schwarz G, Fuchs I, Klewer M, Brittain D, Langer G, Bader B, Prelle K, Nubbemeyer R, Fritzemeier KH: G protein-coupled receptor 30 localizes to the endoplasmic reticulum and is not activated by estradiol. Endocrinology. 2008 Oct;149(10):4846-56. doi: 10.1210/en.2008-0269. Epub 2008 Jun 19. 18566127
  18. Haas E, Bhattacharya I, Brailoiu E, Damjanovic M, Brailoiu GC, Gao X, Mueller-Guerre L, Marjon NA, Gut A, Minotti R, Meyer MR, Amann K, Ammann E, Perez-Dominguez A, Genoni M, Clegg DJ, Dun NJ, Resta TC, Prossnitz ER, Barton M: Regulatory role of G protein-coupled estrogen receptor for vascular function and obesity. Circ Res. 2009 Feb 13;104(3):288-91. doi: 10.1161/CIRCRESAHA.108.190892. Epub 2009 Jan 29. 19179659
  19. Quinn JA, Graeber CT, Frackelton AR Jr, Kim M, Schwarzbauer JE, Filardo EJ: Coordinate regulation of estrogen-mediated fibronectin matrix assembly and epidermal growth factor receptor transactivation by the G protein-coupled receptor, GPR30. Mol Endocrinol. 2009 Jul;23(7):1052-64. doi: 10.1210/me.2008-0262. Epub 2009 Apr 2. 19342448
  20. Vivacqua A, Lappano R, De Marco P, Sisci D, Aquila S, De Amicis F, Fuqua SA, Ando S, Maggiolini M: G protein-coupled receptor 30 expression is up-regulated by EGF and TGF alpha in estrogen receptor alpha-positive cancer cells. Mol Endocrinol. 2009 Nov;23(11):1815-26. doi: 10.1210/me.2009-0120. Epub 2009 Sep 11. 19749156
  21. Madeo A, Maggiolini M: Nuclear alternate estrogen receptor GPR30 mediates 17beta-estradiol-induced gene expression and migration in breast cancer-associated fibroblasts. Cancer Res. 2010 Jul 15;70(14):6036-46. doi: 10.1158/0008-5472.CAN-10-0408. Epub 2010 Jun 15. 20551055
  22. Chan QK, Lam HM, Ng CF, Lee AY, Chan ES, Ng HK, Ho SM, Lau KM: Activation of GPR30 inhibits the growth of prostate cancer cells through sustained activation of Erk1/2, c-jun/c-fos-dependent upregulation of p21, and induction of G(2) cell-cycle arrest. Cell Death Differ. 2010 Sep;17(9):1511-23. doi: 10.1038/cdd.2010.20. Epub 2010 Mar 5. 20203690
  23. Thomas P, Alyea R, Pang Y, Peyton C, Dong J, Berg AH: Conserved estrogen binding and signaling functions of the G protein-coupled estrogen receptor 1 (GPER) in mammals and fish. Steroids. 2010 Aug-Sep;75(8-9):595-602. doi: 10.1016/j.steroids.2009.11.005. Epub 2010 Jan 6. 19931550
  24. Maiti K, Paul JW, Read M, Chan EC, Riley SC, Nahar P, Smith R: G-1-activated membrane estrogen receptors mediate increased contractility of the human myometrium. Endocrinology. 2011 Jun;152(6):2448-55. doi: 10.1210/en.2010-0979. Epub 2011 Mar 22. 21427217
  25. Gros R, Ding Q, Sklar LA, Prossnitz EE, Arterburn JB, Chorazyczewski J, Feldman RD: GPR30 expression is required for the mineralocorticoid receptor-independent rapid vascular effects of aldosterone. Hypertension. 2011 Mar;57(3):442-51. doi: 10.1161/HYPERTENSIONAHA.110.161653. Epub 2011 Jan 17. 21242460
  26. Cheng SB, Quinn JA, Graeber CT, Filardo EJ: Down-modulation of the G-protein-coupled estrogen receptor, GPER, from the cell surface occurs via a trans-Golgi-proteasome pathway. J Biol Chem. 2011 Jun 24;286(25):22441-55. doi: 10.1074/jbc.M111.224071. Epub 2011 May 2. 21540189
  27. Sanden C, Broselid S, Cornmark L, Andersson K, Daszkiewicz-Nilsson J, Martensson UE, Olde B, Leeb-Lundberg LM: G protein-coupled estrogen receptor 1/G protein-coupled receptor 30 localizes in the plasma membrane and traffics intracellularly on cytokeratin intermediate filaments. Mol Pharmacol. 2011 Mar;79(3):400-10. doi: 10.1124/mol.110.069500. Epub 2010 Dec 13. 21149639
  28. Cheng SB, Graeber CT, Quinn JA, Filardo EJ: Retrograde transport of the transmembrane estrogen receptor, G-protein-coupled-receptor-30 (GPR30/GPER) from the plasma membrane towards the nucleus. Steroids. 2011 Aug;76(9):892-6. doi: 10.1016/j.steroids.2011.02.018. Epub 2011 Feb 25. 21354433
  29. Santolla MF, Lappano R, De Marco P, Pupo M, Vivacqua A, Sisci D, Abonante S, Iacopetta D, Cappello AR, Dolce V, Maggiolini M: G protein-coupled estrogen receptor mediates the up-regulation of fatty acid synthase induced by 17beta-estradiol in cancer cells and cancer-associated fibroblasts. J Biol Chem. 2012 Dec 21;287(52):43234-45. doi: 10.1074/jbc.M112.417303. Epub 2012 Nov 7. 23135268
  30. Chakrabarti S, Davidge ST: G-protein coupled receptor 30 (GPR30): a novel regulator of endothelial inflammation. PLoS One. 2012;7(12):e52357. doi: 10.1371/journal.pone.0052357. Epub 2012 Dec 20. 23285008
  31. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. 22814378
  32. Gros R, Ding Q, Liu B, Chorazyczewski J, Feldman RD: Aldosterone mediates its rapid effects in vascular endothelial cells through GPER activation. Am J Physiol Cell Physiol. 2013 Mar;304(6):C532-40. doi: 10.1152/ajpcell.00203.2012. Epub 2013 Jan 2. 23283935
  33. Lenhart PM, Broselid S, Barrick CJ, Leeb-Lundberg LM, Caron KM: G-protein-coupled receptor 30 interacts with receptor activity-modifying protein 3 and confers sex-dependent cardioprotection. J Mol Endocrinol. 2013 Jul 3;51(1):191-202. doi: 10.1530/JME-13-0021. Print 2013. 23674134
  34. Barton M: Position paper: The membrane estrogen receptor GPER--Clues and questions. Steroids. 2012 Aug;77(10):935-42. doi: 10.1016/j.steroids.2012.04.001. Epub 2012 Apr 10. 22521564
  35. Filardo EJ, Thomas P: Minireview: G protein-coupled estrogen receptor-1, GPER-1: its mechanism of action and role in female reproductive cancer, renal and vascular physiology. Endocrinology. 2012 Jul;153(7):2953-62. doi: 10.1210/en.2012-1061. Epub 2012 Apr 11. 22495674